SLC25A28 Rabbit Polyclonal Antibody

CAT#: TA333637

Rabbit Polyclonal Anti-SLC25A28 Antibody

Product Images

WB Suggested Anti-SLC25A28 Antibody Titration: 1 ug/ml; Positive Control: MCF-7 whole cell lysates

• 

  Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SLC25A28 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A28 Antibody: synthetic peptide directed towards the C terminal of human SLC25A28. Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: solute carrier family 25 member 28
• Database Link:
  NP_112489
  Entrez Gene 81894 Human
  UniProt ID Q96A46
• Background: SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.
• Synonyms: 4; MFRN2; MRS3; MRS4L; NPD016
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%