SEC14L4 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of SEC14-like 4 (S. cerevisiae) (SEC14L4), transcript variant 1
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SEC14L4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SEC14L4 Antibody: synthetic peptide directed towards the N terminal of human SEC14L4. Synthetic peptide located within the following region: MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | SEC14 like lipid binding 4 |
Database Link | |
Background | SEC14L4 is a probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.The protein encoded by this gene is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. |
Synonyms | TAP3 |
Note | Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.