RASGEF1C Rabbit Polyclonal Antibody

CAT#: TA333450

Rabbit Polyclonal Anti-RASGEF1C Antibody

Product Images

WB Suggested Anti-RASGEF1C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RASGEF1C Antibody: synthetic peptide directed towards the middle region of human RASGEF1C. Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: RasGEF domain family member 1C
• Database Link:
  NP_778232
  Entrez Gene 255426 Human
  UniProt ID Q8N431
• Background: RASGEF1C is the guanine nucleotide exchange factor (GEF).
• Synonyms: FLJ35841
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%