GMCL1 Rabbit Polyclonal Antibody

CAT#: TA333432

Rabbit Polyclonal Anti-GMCL1 Antibody

Product Images

WB Suggested Anti-GMCL1 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole CellGMCL1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GMCL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human GMCL1. Synthetic peptide located within the following region: QWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: germ cell-less, spermatogenesis associated 1
• Database Link:
  NP_848526
  Entrez Gene 64395 Human
  UniProt ID Q96IK5
• Background: This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein.
• Synonyms: BTBD13; GCL; GCL1; SPATA29
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%