LEMD2 Rabbit Polyclonal Antibody

CAT#: TA333415

Rabbit Polyclonal Anti-LEMD2 Antibody

Product Images

WB Suggested Anti-LEMD2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LEMD2 Antibody: synthetic peptide directed towards the middle region of human LEMD2. Synthetic peptide located within the following region: SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: LEM domain containing 2
• Database Link:
  NP_851853
  Entrez Gene 221496 Human
  UniProt ID Q8NC56
• Background: LEMD2 is involved in nuclear structure organization.
• Synonyms: CTRCT42; dJ482C21.1; NET25
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane