ADPRHL1 Rabbit Polyclonal Antibody

CAT#: TA333338

Rabbit Polyclonal Anti-ADPRHL1 Antibody

Product Images

Host: Rabbit; Target Name: ADPRHL1; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ADPRHL1 Antibody is: synthetic peptide directed towards the middle region of Human ADPRHL1. Synthetic peptide located within the following region: LAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: ADP-ribosylhydrolase like 1
• Database Link:
  NP_954631
  Entrez Gene 113622 Human
  UniProt ID Q8NDY3
• Background: ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL1, reverse the reaction.
• Synonyms: ARH2
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 86%; Rat: 79%