CD32 (FCGR2C) Rabbit Polyclonal Antibody

CAT#: TA333329

Rabbit Polyclonal Anti-FCGR2C Antibody

Product Images

Host: Rabbit; Target Name: FCGR2C; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: FCGR2C; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FCGR2C Antibody is: synthetic peptide directed towards the N-terminal region of Human FCGR2C. Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: Fc fragment of IgG receptor IIc (gene/pseudogene)
• Database Link:
  NP_963857
  Entrez Gene 9103 Human
  UniProt ID P31995
• Background: This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
• Synonyms: CD32; CD32C; CDW32; FCG2; FCRIIC; IGFR2
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 91%; Rabbit: 91%; Bovine: 90%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus