RSPH4A Rabbit Polyclonal Antibody

CAT#: TA332269

Rabbit Polyclonal Anti-RSPH4A Antibody

Product Images

Host: Rabbit; Target Name: RSPH4A; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RSPH4A Antibody is: synthetic peptide directed towards the N-terminal region of Human RSPH4A. Synthetic peptide located within the following region: APPQSDRTTSVIPEAGTPYPDPLEQSSDKRESTPHHTSQSEGNTFQQSQQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: radial spoke head 4 homolog A
• Database Link:
  NP_001010892
  Entrez Gene 345895 Human
  UniProt ID Q5TD94
• Background: This gene encodes a protein that appears to be a component the radial spoke head, as determined by homology to similar proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates. Radial spokes, which are regularly spaced along cilia, sperm, and flagella axonemes, consist of a thin 'stalk' and a bulbous 'head' that form a signal transduction scaffold between the central pair of microtubules and dynein. Mutations in this gene cause primary ciliary dyskinesia 1, a disease arising from dysmotility of motile cilia and sperm. Alternative splicing results in multiple transcript variants.
• Synonyms: CILD11; dJ412I7.1; RSHL3; RSPH6B
• Note: Immunogen sequence homology: Human: 100%