NIPAL4 Rabbit Polyclonal Antibody

SKU TA332160

Rabbit Polyclonal Anti-NIPAL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NIPAL4 Antibody is: synthetic peptide directed towards the N-terminal region of Human NIPAL4. Synthetic peptide located within the following region: LGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAPGPMELRVSNT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: NIPA like domain containing 4
• Database Link:
  NP_001165763
  Q0D2K0
• Background: This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis.
• Synonyms: ARCI6; ICHTHYIN; ICHYN
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane