RSRC1 Rabbit Polyclonal Antibody

CAT#: TA331904

Rabbit Polyclonal Anti-RSRC1 Antibody

Product Images

Host: Rabbit; Target Name: RSRC1; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; RSRC1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RSRC1 Antibody is: synthetic peptide directed towards the N-terminal region of Human RSRC1. Synthetic peptide located within the following region: SRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: arginine/serine-rich coiled-coil 1
• Database Link:
  NP_057709
  Entrez Gene 51319 Human
  UniProt ID Q96IZ7
• Background: Serine- and arginine-rich (SR) proteins and SR-related proteins, like RSRC1, function in spliceosome assembly and participate in multiple steps of mRNA splicing.
• Synonyms: BM-011; SFRS21; SRrp53
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%