Myoneurin (MYNN) Rabbit Polyclonal Antibody

CAT#: TA331851

Rabbit Polyclonal Anti-MYNN Antibody

Product Images

WB Suggested Anti-MYNN Antibody Titration: 2.5ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYNN Antibody: synthetic peptide directed towards the middle region of human MYNN. Synthetic peptide located within the following region: KSPYEAENSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: myoneurin
• Database Link:
  NP_061127
  Entrez Gene 55892 Human
  UniProt ID Q9NPC7
• Background: Myoneurin belongs to the BTB/POZ and zinc finger protein family. The BTB/POZ and zinc finger proteins (BTB/POZ-ZF) constitute a growing family of proteins with gene expression regulatory functions since they have been shown to be involved in both transcriptional activation and repression of various genes in a broad range of species.
• Synonyms: OSZF; SBBIZ1; ZBTB31; ZNF902
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors