ABCG5 Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "ABCG5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 72 kDa |
Gene Name | ATP binding cassette subfamily G member 5 |
Database Link | |
Background | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia. |
Synonyms | STSL |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | ABC transporters |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.