PDZD7 Rabbit Polyclonal Antibody

CAT#: TA331728

Rabbit Polyclonal Anti-PDZD7 Antibody

Product Images

Host: Rabbit; Target Name: PDZD7; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDZD7 Antibody is: synthetic peptide directed towards the C-terminal region of Human PDZD7. Synthetic peptide located within the following region: LSRPRPPITRSQSYLTLWEEKQQRKKEKSGSPGEKGALQRSKTLMNLFFK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: PDZ domain containing 7
• Database Link:
  NP_079171
  Entrez Gene 79955 Human
  UniProt ID Q9H5P4
• Background: This gene encodes a ciliary protein homologous to proteins which are mutated in Usher syndrome patients, and mutations and translocations involving this gene have been associated with two types of Usher syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: PDZK7
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%