DIPK2B Rabbit Polyclonal Antibody

CAT#: TA331576

Rabbit Polyclonal Anti-CXorf36 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of chromosome X open reading frame 36 (CXorf36), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "DIPK2B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CXorf36 Antibody is: synthetic peptide directed towards the N-terminal region of Human CXorf36. Synthetic peptide located within the following region: GLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name chromosome X open reading frame 36
Background The function of this protein remains unknown.
Synonyms 4930578C19Rik; bA435K1.1; DIA1R; EPQL1862; PRO3743
Note Immunogen sequence homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Horse: 86%; Mouse: 86%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.