LINC02694 Rabbit Polyclonal Antibody

CAT#: TA331486

Rabbit Polyclonal Anti-C15orf53 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of chromosome 15 open reading frame 53 (C15orf53)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "C15orf53"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-C15orf53 Antibody is: synthetic peptide directed towards the N-terminal region of Human C15orf53. Synthetic peptide located within the following region: LGISLSSPRRNHETRPGSKAKGRSSICLQASVWMAGGKLRLRASEHLTQG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 20 kDa
Gene Name chromosome 15 open reading frame 53
Background The function of this protein remains unknown.
Synonyms FLJ35695; MGC148119
Note Immunogen sequence homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.