C17orf78 Rabbit Polyclonal Antibody

CAT#: TA331405

Rabbit polyclonal Anti-C17orf78 Antibody

Product Images

WB Suggested Anti-C17orf78 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C17orf78 antibody: synthetic peptide directed towards the middle region of human C17orf78. Synthetic peptide located within the following region: LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: chromosome 17 open reading frame 78
• Database Link:
  NP_775896
  Entrez Gene 284099 Human
  UniProt ID Q8N4C9
• Background: The exact function of the protein encoded by this gene is not known.
• Synonyms: FLJ39647; MGC34759
• Note: Human: 100%

Reference Data

• Protein Families: Transmembrane