CBARA1 (MICU1) Rabbit Polyclonal Antibody

CAT#: TA331380

Rabbit Polyclonal Anti-MICU1 Antibody

Product Images

WB Suggested Anti-MICU1 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole CellMICU1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MICU1 antibody is: synthetic peptide directed towards the C-terminal region of Human MICU1. Synthetic peptide located within the following region: LSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: mitochondrial calcium uptake 1
• Database Link:
  NP_001182448
  Entrez Gene 10367 Human
  UniProt ID Q9BPX6
• Background: MICU1 is a key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. It may act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner. MICU1 induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG.
• Synonyms: CALC; CBARA1; EFHA3; MPXPS
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%