PAPLN Rabbit Polyclonal Antibody

CAT#: TA331345

Rabbit Polyclonal Anti-PAPLN Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of papilin, proteoglycan-like sulfated glycoprotein (PAPLN)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "PAPLN"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PAPLN antibody is: synthetic peptide directed towards the C-terminal region of Human PAPLN. Synthetic peptide located within the following region: YQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name papilin, proteoglycan-like sulfated glycoprotein
Background The function of this protein remains unknown.
Synonyms DKFZp434F053; MGC50452
Note Human: 100%; Bovine: 93%; Pig: 86%; Dog: 79%; Horse: 79%; Rat: 75%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.