OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WHAMM Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331240
Rabbit Polyclonal Anti-WHAMM Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY421652 Transient overexpression lysate of WAS protein homolog associated with actin, golgi membranes and microtubules (WHAMM) (as WB positive control) 100 ug
$665.00
TP316211 Recombinant protein of human WAS protein homolog associated with actin, golgi membranes and microtubules (WHAMM), 20 µg
20 ug
$737.00

View other "WHAMM or NM_001080435" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-WHAMM antibody is: synthetic peptide directed towards the C-terminal region of Human WHAMM. Synthetic peptide located within the following region: SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 91 kDa
Gene Name WAS protein homolog associated with actin, golgi membranes and microtubules
Database Link
Background WHAMM acts as a nucleation-promoting factor (NPF) that stimulates Arp2/3-mediated actin polymerization both at the Golgi apparatus and along tubular membranes. WHAMM is involved as a regulator of Golgi positioning and morphology. WHAMM participates in vesicle transport between the reticulum endoplasmic and the Golgi complex.
Synonyms WHAMM1; WHDC1
Note Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 85%
Reference Data
Protein Categories Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products