PDGFRL Rabbit Polyclonal Antibody

CAT#: TA331218

Rabbit Polyclonal Anti-PDGFRL Antibody

Product Images

WB Suggested Anti-PDGFRL Antibody; Titration: 1.0 ug/ml; Positive Control: RPMI-8226 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PDGFRL antibody is: synthetic peptide directed towards the N-terminal region of Human PDGFRL. Synthetic peptide located within the following region: KVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: platelet derived growth factor receptor like
• Database Link:
  NP_006198
  Entrez Gene 5157 Human
  UniProt ID Q15198
• Background: This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor.
• Synonyms: PDGRL; PRLTS
• Note: Human: 100%; Pig: 79%; Rat: 79%; Horse: 79%; Bovine: 75%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein