Mboat2 Rabbit Polyclonal Antibody

CAT#: TA331029

Rabbit polyclonal Anti-Mboat2 Antibody

Product Images

Host: Rabbit; Target Name: Mboat2; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mboat2 antibody is: synthetic peptide directed towards the middle region of Rat Mboat2. Synthetic peptide located within the following region: GMFRKDEELTPSQRGLAVRRMPSLLEYVSYTCNFMGILAGPLCSYKDYIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: membrane bound O-acyltransferase domain containing 2
• Database Link:
  NP_001101486
  Entrez Gene 313997 Rat
  UniProt ID Q3T1J2
• Background: Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle.
• Synonyms: FLJ14415; FLJ90298; LPAAT; LPCAT4; LPEAT; OACT2
• Note: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%