Transglutaminase 6 (TGM6) Rabbit Polyclonal Antibody

CAT#: TA331020

Rabbit polyclonal Anti-TGM6 Antibody

Product Images

WB Suggested Anti-TGM6 Antibody Titration: 0.2-1 ug/ml; Positive Control: NTERA2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TGM6 antibody: synthetic peptide directed towards the middle region of human TGM6. Synthetic peptide located within the following region: KKIGRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: transglutaminase 6
• Database Link:
  NP_945345
  Entrez Gene 343641 Human
  UniProt ID O95932
• Background: TGM6 belongs to the transglutaminase superfamily and catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
• Synonyms: dJ734P14.3; SCA35; TG6; TGM3L; TGY
• Note: Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome