VN1R4 Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "VN1R4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-VN1R4 antibody is: synthetic peptide directed towards the C-terminal region of Human VN1R4. Synthetic peptide located within the following region: LGLMLWVSSSMVCILHRHKQRVQHIDRSDLSPRASPENRATQSILILVST |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 33 kDa |
Gene Name | vomeronasal 1 receptor 4 |
Database Link | |
Background | VN1R4 is a putative pheromone receptor. |
Synonyms | V1RL4 |
Note | Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Horse: 86%; Goat: 85%; Pig: 77%; Sheep: 77%; Bovine: 77%; Guinea pig: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.