VN1R4 Rabbit Polyclonal Antibody

CAT#: TA330820

Rabbit Polyclonal Anti-VN1R4 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "VN1R4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-VN1R4 antibody is: synthetic peptide directed towards the C-terminal region of Human VN1R4. Synthetic peptide located within the following region: LGLMLWVSSSMVCILHRHKQRVQHIDRSDLSPRASPENRATQSILILVST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name vomeronasal 1 receptor 4
Background VN1R4 is a putative pheromone receptor.
Synonyms V1RL4
Note Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 92%; Horse: 86%; Goat: 85%; Pig: 77%; Sheep: 77%; Bovine: 77%; Guinea pig: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.