MAB21L4 Rabbit Polyclonal Antibody

CAT#: TA330755

Rabbit Polyclonal Anti-C2orf54 Antibody

Product Images

Host: Rabbit; Target Name: C2orf54; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C2orf54 antibody is: synthetic peptide directed towards the C-terminal region of Human C2orf54. Synthetic peptide located within the following region: LKALLQLPASDPTYWATAYFDVLLDKFQVFNIQDKDRISAMQSIFQKTRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: chromosome 2 open reading frame 54
• Database Link:
  NP_001078906
  Entrez Gene 79919 Human
  UniProt ID Q08AI8
• Background: The function of this protein remains unknown.
• Synonyms: FLJ22671; MGC150431; MGC150432
• Note: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 77%