C1orf135 (AUNIP) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AUNIP antibody is: synthetic peptide directed towards the N-terminal region of Human AUNIP. Synthetic peptide located within the following region: RAPSTGIHQRSIASFFTLQPGKTNGSDQKSVSSHTESQINKESKKNATQL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 40 kDa |
Gene Name | aurora kinase A and ninein interacting protein |
Database Link | |
Background | AUNIP is required for the dynamic movement of AURKA at the centrosomes and spindle apparatus during the cell cycle. |
Synonyms | AIBP; C1orf135 |
Note | Human: 100%; Pig: 86%; Horse: 86%; Rabbit: 85%; Dog: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review