TMBIM1 Rabbit Polyclonal Antibody

CAT#: TA330714

Rabbit Polyclonal Anti-TMBIM1 Antibody

Product Images

Host: Rabbit; Target Name: TMBIM1; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMBIM1 antibody is: synthetic peptide directed towards the N-terminal region of Human TMBIM1. Synthetic peptide located within the following region: GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: transmembrane BAX inhibitor motif containing 1
• Database Link:
  NP_071435
  Entrez Gene 64114 Human
  UniProt ID Q969X1
• Background: TMBIM1 negatively regulates aortic matrix metalloproteinase-9 (MMP9) production and may play a protective role in vascular remodeling.
• Synonyms: LFG3; MST100; MSTP100; PP1201; RECS1
• Note: Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 92%; Bovine: 92%; Dog: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane