SND1 Rabbit Polyclonal Antibody

CAT#: TA330608

Rabbit Polyclonal Anti-SND1 Antibody

Product Images

WB Suggested Anti-SND1 Antibody Titration: 1.25ug/ml; Positive Control: Raji cell lysateSND1 is supported by BioGPS gene expression data to be expressed in Raji

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SND1 antibody: synthetic peptide directed towards the N terminal of human SND1. Synthetic peptide located within the following region: LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 100 kDa
• Gene Name: staphylococcal nuclease and tudor domain containing 1
• Database Link:
  NP_055205
  Entrez Gene 27044 Human
  UniProt ID Q7KZF4
• Background: SND1 was originally characterized as a transcriptional coactivator for Epstein-Barr virus nuclear antigen 2. It is a STAT6 TAD interacting protein containing staphylococcal nuclease (SN)-like domain and tudor domain. p100 . The interaction is mediated by the TAD domain of STAT6 and the SN-like domain of SND1. SND1 associates with the large subunit of RNA polymerase II and is mediating interaction between STAT6 and RNA polymerase II. It was identified as a novel coactivator for STAT6 and suggest its functions as a bridging factor between STAT6 and the basal transcription machinery
• Synonyms: p100; TDRD11
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors