SND1 Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SND1 antibody: synthetic peptide directed towards the N terminal of human SND1. Synthetic peptide located within the following region: LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 100 kDa |
Gene Name | staphylococcal nuclease and tudor domain containing 1 |
Database Link | |
Background | SND1 was originally characterized as a transcriptional coactivator for Epstein-Barr virus nuclear antigen 2. It is a STAT6 TAD interacting protein containing staphylococcal nuclease (SN)-like domain and tudor domain. p100 . The interaction is mediated by the TAD domain of STAT6 and the SN-like domain of SND1. SND1 associates with the large subunit of RNA polymerase II and is mediating interaction between STAT6 and RNA polymerase II. It was identified as a novel coactivator for STAT6 and suggest its functions as a bridging factor between STAT6 and the basal transcription machinery |
Synonyms | p100; TDRD11 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review