Nicotinic Acetylcholine Receptor beta 2 (CHRNB2) Rabbit Polyclonal Antibody

CAT#: TA330426

Rabbit Polyclonal Anti-CHRNB2 Antibody

Product Images

WB Suggested Anti-CHRNB2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the N terminal of human CHRNB2. Synthetic peptide located within the following region: SGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: cholinergic receptor nicotinic beta 2 subunit
• Database Link:
  NP_000739
  Entrez Gene 11444 MouseEntrez Gene 1141 Human
  UniProt ID P17787
• Background: CHRNB2 is a neuronal nicotinic acetylcholine receptor (nAChR) that belong to ligand-gated ion channels composed of alpha and beta subunits with specific structural, functional and pharmacological properties.
• Synonyms: EFNL3; nAChRB2
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; African clawed frog: 92%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane