Caveolin 2 (CAV2) Rabbit Polyclonal Antibody

CAT#: TA330402

Rabbit Polyclonal Anti-CAV2 Antibody

Product Images

WB Suggested Anti-CAV2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Lung

• 

  Lanes: Lane 1: 50 ug human placental tissue lysate; Lane 2: 40 ug human placental tissue lysate; Lane 3: 30 ug human placental tissue lysate; Lane 4: 20 ug human placental tissue lysate; Lane 5: 20 ug human myometrial tissue lysate; Primary Antibody Dilution:

• 

  Sample Type : Human placental tissue Primary Antibody Dilution : 1:50Secondary Antibody : Goat anti rabbit-HRP Secondary Antibody Dilution : 1:10,000Color/Signal Descriptions : Brown: CAV2 Purple: HaemotoxylinGene Name : CAV2Submitted by : Dr. Hiten D. Mi

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAV2 antibody: synthetic peptide directed towards the N terminal of human CAV2. Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: caveolin 2
• Database Link:
  NP_001224
  Entrez Gene 858 Human
  UniProt ID P51636
• Background: CAV2 is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript.
• Synonyms: CAV
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Focal adhesion