Esrrg Rabbit Polyclonal Antibody

CAT#: TA330221

Rabbit Polyclonal Anti-Esrrg Antibody

Product Images

WB Suggested Anti-Esrrg Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Esrrg antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: estrogen-related receptor gamma
• Database Link:
  NP_976081
  Entrez Gene 360896 Rat
  UniProt ID P62510
• Background: Esrrg is an orphan receptor that acts as transcription activator in the absence of bound ligand. It binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
• Synonyms: DKFZp781L1617; ERR3; ERRG2; ERRgamma; FLJ16023; KIAA0832; NR3B3; OTTHUMP00000035092; OTTHUMP00000035095; OTTHUMP00000035115; OTTHUMP00000035116; OTTHUMP00000035126
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%