ATF6 beta (ATF6B) Rabbit Polyclonal Antibody

CAT#: TA330184

Rabbit Polyclonal Anti-CREBL1 Antibody

Product Images

WB Suggested Anti-CREBL1 Antibody Titration: 1.0ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CREBL1 antibody: synthetic peptide directed towards the N terminal of human CREBL1. Synthetic peptide located within the following region: EIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: activating transcription factor 6 beta
• Database Link:
  NP_004372
  Entrez Gene 1388 Human
  UniProt ID Q99941
• Background: CREBL1 bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6.
• Synonyms: CREB-RP; CREBL1; G13
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors