ATF7 Rabbit Polyclonal Antibody

CAT#: TA330084

Rabbit Polyclonal Anti-ATF7 Antibody

Product Images

WB Suggested Anti-ATF7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATF7 antibody: synthetic peptide directed towards the N terminal of human ATF7. Synthetic peptide located within the following region: ASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: activating transcription factor 7
• Database Link:
  NP_006847
  Entrez Gene 11016 Human
  UniProt ID P17544
• Background: The human ATF7(ATFa) proteins belong to the ATF/CREB family of transcription factors.They mediate the transcriptional activation by the largest E1a protein and can heterodimerize with members of the Jun/Fos family. ATFa proteins have also been found tightly associated with JNK2, a stress-activated kinase. Four variants of ATFa (ATFa0, ATFa1, ATFa2, and ATFa3) have been characterized.
• Synonyms: ATFA
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Dog: 92%; Guinea pig: 92%; Horse: 84%; Rat: 84%; Mouse: 78%

Reference Data

• Protein Families: Transcription Factors