DMRT1 Rabbit Polyclonal Antibody

CAT#: TA330051

Rabbit Polyclonal Anti-DMRT1 Antibody

Product Images

WB Suggested Anti-DMRT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DMRT1 antibody: synthetic peptide directed towards the N terminal of human DMRT1. Synthetic peptide located within the following region: PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: doublesex and mab-3 related transcription factor 1
• Database Link:
  NP_068770
  Entrez Gene 1761 Human
  UniProt ID Q9Y5R6
• Background: The gene encodes the DMRT1 protein is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. This suggested that DMRT1 may be required for testis development.This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CT154; DMT1
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%; Dog: 85%; Bovine: 78%; Pig: 78%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors