Gatad2a Rabbit Polyclonal Antibody

CAT#: TA329994

Rabbit Polyclonal Anti-GATAD2A Antibody

Product Images

WB Suggested Anti-GATAD2A Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GATAD2A antibody: synthetic peptide directed towards the N terminal of mouse GATAD2A. Synthetic peptide located within the following region: MSEEACRTRSQKRTLEPDLTEDDVENKKMKMEKGSSELTVDGDSRVMPEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: GATA zinc finger domain containing 2A
• Database Link:
  NP_663571
  Entrez Gene 234366 Mouse
  UniProt ID Q8CHY6
• Background: GATAD2A's function is not determined.
• Synonyms: FLJ20085; FLJ21017; Hp66alpha; OTTHUMP00000201911; p66alpha
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 92%; Human: 91%