Nr5a1 Rabbit Polyclonal Antibody

CAT#: TA329986

Rabbit Polyclonal Anti-Nr5a1 Antibody

Product Images

Host: Rabbit; Target Name: Nr5a1; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nr5a1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr5a1. Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: nuclear receptor subfamily 5, group A, member 1
• Database Link:
  NP_620639
  Entrez Gene 26423 Mouse
  UniProt ID P33242
• Background: Nr5a1 is a transcriptional activator. It seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. It binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Nr5a1 also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Transcription repressor of the Moloney leukemia virus long terminal repeat in undifferentiated murine embryonal carcinoma cells. Nr5a1 binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular phosphatidyl(3,4)bisphosphate, phosphatidyl(3,5)bisphosphate and phosphatidyl(3,4,5)triphosphate. Nr5a1 is activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation.
• Synonyms: AD4BP; ELP; FTZ1; FTZF1; POF7; SF-1; SF1; STF-1
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Human: 86%; Rabbit: 86%; Sheep: 79%; Bovine: 79%