Taf7l Rabbit Polyclonal Antibody

CAT#: TA329955

Rabbit Polyclonal Anti-TAF7L Antibody

Product Images

WB Suggested Anti-TAF7L Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF7L antibody: synthetic peptide directed towards the middle region of mouse TAF7L. Synthetic peptide located within the following region: DEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: TATA-box binding protein associated factor 7 like
• Database Link:
  NP_083234
  Entrez Gene 74469 Mouse
  UniProt ID Q9D3R9
• Background: TAF7I belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).
• Synonyms: CT40; FLJ23157; TAF2Q
• Note: Immunogen sequence homology: Mouse: 100%; Yeast: 100%; Rat: 83%