Sra1 Rabbit Polyclonal Antibody

CAT#: TA329929

Rabbit Polyclonal Anti-Sra1 Antibody

Product Images

WB Suggested Anti-Sra1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sra1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: steroid receptor RNA activator 1
• Database Link:
  NP_079567
  Entrez Gene 24068 Mouse
  UniProt ID Q80VJ2
• Background: Sra1 is a functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Sra1 also mediates transcriptional coactivation of steroid receptors ligand-dependently through the steroid-binding domain (AF-2).Sra1 enhances cellular proliferation and differentiation and promotes apoptosis in vivo. Sra1 may play a role in tumorigenesis.
• Synonyms: MGC87674; pp7684; SRA; SRAP; STRAA1
• Note: Immunogen sequence homology: Dog: 93%; Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%; Bovine: 86%; Guinea pig: 86%