UBQLN2 Rabbit Polyclonal Antibody

CAT#: TA329850

Rabbit Polyclonal Anti-UBR2 Antibody

Product Images

Host: Rabbit; Target Name: UBR2; Sample Tissue: Fetal Small Intestine lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-UBR2 antibody is: synthetic peptide directed towards the C-terminal region of Human UBR2. Synthetic peptide located within the following region: GLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDSKLW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: ubiquilin 2
• Database Link:
  NP_038472
  Entrez Gene 29978 Human
  UniProt ID Q9UHD9
• Background: Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron.
• Synonyms: ALS15; CHAP1; DSK2; HRIHFB2157; N4BP4; PLIC2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome