C14orf48 (LINC00521) Rabbit Polyclonal Antibody

CAT#: TA329796

Rabbit polyclonal Anti-C14orf48 Antibody

Product Images

WB Suggested Anti-C14orf48 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C14orf48 antibody: synthetic peptide directed towards the N terminal of human C14orf48. Synthetic peptide located within the following region: MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: long intergenic non-protein coding RNA 521
• Database Link:
  NP_689990
  Entrez Gene 256369 Human
• Background: The function of C14orf48 remains unknown.
• Synonyms: c14_5713; MGC33356
• Note: Immunogen sequence homology: Human: 100%