ZNF81 Rabbit Polyclonal Antibody

CAT#: TA329731

Rabbit Polyclonal Anti-ZNF81 Antibody

Product Images

WB Suggested Anti-ZNF81 Antibody Titration: 0.5ug/ml; Positive Control: Jurkat cell lysate

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF81 antibody: synthetic peptide directed towards the middle region of human ZNF81. Synthetic peptide located within the following region: QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Database Link:
  NP_009068.2
  Entrez Gene 347344 Human
• Background: Zinc Finger Protein 81 is a new candidate transcription factor.
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%

Reference Data

• Protein Families: Transcription Factors