CSEN (KCNIP3) Rabbit Polyclonal Antibody

CAT#: TA329702

Rabbit Polyclonal Anti-CSEN Antibody

Product Images

WB Suggested Anti-CSEN Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSEN antibody: synthetic peptide directed towards the N terminal of human CSEN. Synthetic peptide located within the following region: STVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: potassium voltage-gated channel interacting protein 3
• Database Link:
  NP_038462
  Entrez Gene 56461 MouseEntrez Gene 30818 Human
  UniProt ID Q9Y2W7
• Background: CSEN is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The protein encoded by this gene is also shown to function as a calcium-regulated transcriptional repressor, and to interact with presenilins. Mutations in the presenilin genes have been implicated in Alzheimer's disease.
• Synonyms: CSEN; DREAM; KCHIP3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors, Transmembrane