Activator of basal transcription 1 (ABT1) Rabbit Polyclonal Antibody

CAT#: TA329691

Rabbit Polyclonal Anti-ABT1 Antibody

Product Images

WB Suggested Anti-ABT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 721_B cell lysateABT1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the N terminal of human ABT1. Synthetic peptide located within the following region: VGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: activator of basal transcription 1
• Database Link:
  NP_037507
  Entrez Gene 29777 Human
  UniProt ID Q9ULW3
• Background: Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.
• Synonyms: hABT1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors