Ebf4 Rabbit Polyclonal Antibody

CAT#: TA329589

Rabbit polyclonal anti-Ebf4 antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Ebf4"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Ebf4 antibody: synthetic peptide directed towards the middle region of human Ebf4. Synthetic peptide located within the following region: ARSCGSASPRFAPSPGSQQSSYGSGLGAGLGSYGAPGVTGLGVPGSPSFL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name early B cell factor 4
Background The function of this protein remains unknown.
Synonyms COE4; EBF-4; KIAA1442; O/E-4; OE-4; RP5-860F19.3
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Human: 92%; Bovine: 92%; Guinea pig: 92%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.