RFFL Rabbit Polyclonal Antibody

CAT#: TA329559

Rabbit Polyclonal anti-RFFL antibody

Product Images

WB Suggested Anti-RFFL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFFL antibody: synthetic peptide directed towards the middle region of human RFFL. Synthetic peptide located within the following region: KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: ring finger and FYVE-like domain containing E3 ubiquitin protein ligase
• Database Link:
  NP_476519
  Entrez Gene 117584 Human
  UniProt ID Q8WZ73
• Background: RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. Has anti-apoptotic activity.RFFL may bind phosphatidylinositol phosphates.
• Synonyms: CARP2; fring; FYVE-RING finger protein SAKURA; RIFIFYLIN; ring finger and FYVE-like domain containing 1; RNF34L; RNF189
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome