ZNF652 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 652 (ZNF652), transcript variant 2
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "ZNF652"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF652 antibody: synthetic peptide directed towards the N terminal of human ZNF652. Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 70 kDa |
Gene Name | zinc finger protein 652 |
Database Link | |
Background | ZNF652 is a new candidate transcription factor. |
Synonyms | DKFZp781E2122; KIAA0924 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Goat: 91%; Yeast: 91%; Rabbit: 90%; Bovine: 88%; Horse: 87%; Pig: 78% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.