ZNF652 Rabbit Polyclonal Antibody

CAT#: TA329381

Rabbit Polyclonal anti-ZNF652 antibody

Product Images

WB Suggested Anti-ZNF652 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysateZNF652 is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Rabbit Anti-ZNF652 antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF652 antibody: synthetic peptide directed towards the N terminal of human ZNF652. Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: zinc finger protein 652
• Database Link:
  NP_055712
  Entrez Gene 22834 Human
  UniProt ID Q9Y2D9
• Background: ZNF652 is a new candidate transcription factor.
• Synonyms: DKFZp781E2122; KIAA0924
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Goat: 91%; Yeast: 91%; Rabbit: 90%; Bovine: 88%; Horse: 87%; Pig: 78%