EN2 Rabbit Polyclonal Antibody

CAT#: TA329251

Rabbit Polyclonal anti-EN2 Antibody

Product Images

WB Suggested Anti-EN2 Antibody Titration: 0.05ug/ml; ELISA Titer: 1:2500; Positive Control: Human cerebellum

• 

  Rabbit Anti-EN2 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Human Kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EN2 antibody is: synthetic peptide directed towards the C-terminal region of Human EN2. Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: engrailed homeobox 2
• Database Link:
  NP_001418
  Entrez Gene 2020 Human
  UniProt ID P19622
• Background: Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
• Synonyms: AUTS1; AUTS10; engrailed-2; engrailed homeobox 2; engrailed homolog 2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS