C2orf28 (ATRAID) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of chromosome 2 open reading frame 28 (C2orf28), transcript variant 1
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "C2orf28"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 18 kDa |
Gene Name | all-trans retinoic acid induced differentiation factor |
Database Link | |
Background | The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | APR--3; APR-3; APR3; C2orf28; HSPC013; p18; PRO240 |
Note | Immunogen sequence homology: Human: 100%; Dog: 87%; Pig: 87%; Rat: 87%; Mouse: 87%; Bovine: 87%; Rabbit: 87% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.