CRKL Rabbit Polyclonal Antibody

CAT#: TA329153

Rabbit Polyclonal anti-CRKL Antibody

Product Images

WB Suggested Anti-CRKL Antibody; Titration: 1.0 ug/ml; Positive Control: K562 Whole CellCRKL is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: v-crk avian sarcoma virus CT10 oncogene homolog-like
• Database Link:
  NP_005198
  Entrez Gene 1399 Human
  UniProt ID P46109
• Background: CRKL has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase and plays a role in fibroblast transformation by BCR-ABL. In addition, CRKL has oncogenic potential.
• Synonyms: v-crk avian sarcoma virus CT10 oncogene homolog-like; v-crk sarcoma virus CT10 oncogene homolog (avian)-like

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma