TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]
Other products for "ANO1"
Specifications
Product Data | |
Clone Name | DOG1.1 |
Applications | IHC |
Recommended Dilution | Immunohistochemistry on Formalin-fixed Sections: 1.0 - 2.0 μg/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes. Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin. |
Reactivities | Human |
Host | Mouse |
Isotype | IgG1 |
Clonality | Monoclonal |
Immunogen | A synthetic peptide from Human DOG-1 protein (MSDFV DWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSP APSHAYHGGVL), conjugated to a carrier protein. |
Specificity | Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%. Cellular Localization: Cell Surface and Cytoplasmic. |
Formulation | 10mM PBS State: Purified State: Liquid purified IgG fraction from Bioreactor Concentrate Stabilizer: 0.05% BSA Preservative: 0.05% Sodium Azide |
Concentration | lot specific |
Purification | Protein A/G Chromatography |
Conjugation | Unconjugated |
Storage | Store undiluted at 2-8°C. |
Stability | Shelf life: one year from despatch. |
Predicted Protein Size | ~114 kDa |
Gene Name | anoctamin 1 |
Database Link | |
Background | DOG1 gene, a gastrointestinal stromal tumor (GIST) specific gene, encoding for the hypothetical protein FLJ10261, which was named Discovered on GIST 1 (DOG1). DOG1 protein is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFR alpha mutation status. |
Synonyms | Anoctamin-1, Transmembrane protein 16A, DOG-1, ORAOV2, TAOS2, TMEM16A |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.