TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: DOG1.1]

CAT#: AM33350PU-T

TMEM16A (ANO1) mouse monoclonal antibody, clone DOG1.1, Purified

Size: 20 ug 100 ug


USD 315.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "ANO1"

Specifications

Product Data
Clone Name DOG1.1
Applications IHC
Recommended Dilution Immunohistochemistry on Formalin-fixed Sections: 1.0 - 2.0 μg/ml for 30 minutes at RT.
Staining of formalin-fixed tissues requires boiling tissue sections in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling at RT for 20 minutes.
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Reactivities Human
Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen A synthetic peptide from Human DOG-1 protein (MSDFV DWVIPDIPKDISQQIHK-EKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSP APSHAYHGGVL), conjugated to a carrier protein.
Specificity Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST’s), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST’s, including all c-kit negative GIST’s. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST’s is nearly identical: 94.4% vs. 94.7%.
Cellular Localization: Cell Surface and Cytoplasmic.
Formulation 10mM PBS
State: Purified
State: Liquid purified IgG fraction from Bioreactor Concentrate
Stabilizer: 0.05% BSA
Preservative: 0.05% Sodium Azide
Concentration lot specific
Purification Protein A/G Chromatography
Conjugation Unconjugated
Storage Store undiluted at 2-8°C.
Stability Shelf life: one year from despatch.
Predicted Protein Size ~114 kDa
Gene Name anoctamin 1
Background DOG1 gene, a gastrointestinal stromal tumor (GIST) specific gene, encoding for the hypothetical protein FLJ10261, which was named Discovered on GIST 1 (DOG1). DOG1 protein is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFR alpha mutation status.
Synonyms Anoctamin-1, Transmembrane protein 16A, DOG-1, ORAOV2, TAOS2, TMEM16A
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.