Kv1.2 (KCNA2) Mouse Monoclonal Antibody [Clone ID: L76/36]
Other products for "KCNA2"
Specifications
Product Data | |
Clone Name | L76/36 |
Applications | IF, IHC, WB |
Recommended Dilution | Immunoblot, Immunocytochemistry and Immunohistochemistry |
Reactivities | Human, Mouse, Rat |
Host | Mouse |
Isotype | IgG2a |
Clonality | Monoclonal |
Immunogen | Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480). Mouse: 100% identity (72/72 amino acids identical) Rat: 100% identity (72/72 amino acids identical) Some identity with Kv1.1, Kv1.3 and Kv1.4 |
Formulation | State: Purified |
Conjugation | Unconjugated |
Gene Name | potassium voltage-gated channel subfamily A member 2 |
Database Link | |
Synonyms | Potassium voltage-gated channel subfamily A member 2, Voltage-gated potassium channel subunit Kv1.2, HBK5, NGK1, HUKIV, KCNA2 |
Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.