Kv1.2 (KCNA2) Mouse Monoclonal Antibody [Clone ID: L76/36]

CAT#: 75-314

Kv1.2 (KCNA2) mouse monoclonal antibody, clone L76/36

Product Images

Adult rat brain membrane immunoblot

Specifications

Product Data

• Clone Name: L76/36
• Applications: IF, IHC, WB
• Recommended Dilution: Immunoblot, Immunocytochemistry and Immunohistochemistry
• Reactivities: Human, Mouse, Rat
• Host: Mouse
• Isotype: IgG2a
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480).
  Mouse: 100% identity (72/72 amino acids identical)
  Rat: 100% identity (72/72 amino acids identical)
  Some identity with Kv1.1, Kv1.3 and Kv1.4
• Formulation: State: Purified
• Conjugation: Unconjugated
• Gene Name: potassium voltage-gated channel subfamily A member 2
• Database Link:
  Entrez Gene 3737 Human
  UniProt ID P16389
• Synonyms: Potassium voltage-gated channel subfamily A member 2, Voltage-gated potassium channel subunit Kv1.2, HBK5, NGK1, HUKIV, KCNA2
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
  "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
  Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
  View Research License Agreement